Rabbit anti-Human Lysozyme (LYZ) Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16554P

• Product Name:
• Rabbit anti-Human Lysozyme (LYZ) Monoclonal Antibody

• Synonym:
• LZM; LYZF1; Lysozyme (LYZ)

• Description:
• The antibody against Lysozyme (LYZ) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (LYZ) (P61626) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (LYZ) (P61626).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Lysozyme (LYZ)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS

• Gene ID:
• 4069

• Uniprot-ID:
• P61626

• Purification Method:
• HepG2, RAW 264.7, THP-1, U-937, Mouse lung

• Positive Samples:
• Affinity purification