Rabbit anti-Human LILRA2/CD85h Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15777P

• Product Name:
• Rabbit anti-Human LILRA2/CD85h Monoclonal Antibody

• Synonym:
• ILT1; LIR7; CD85H; LIR-7

• Description:
• The antibody against LILRA2/CD85h was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-449 of human LILRA2/CD85h (NP_001124389.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 24-449 of human LILRA2/CD85h (NP_001124389.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.5% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• LILRA2/CD85h

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVEN

• Gene ID:
• 11027

• Uniprot-ID:
• Q8N149

• Positive Samples:
• Affinity purification