Rabbit anti-Human LC3B Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17165P

• Product Name:
• Rabbit anti-Human LC3B Monoclonal Antibody

• Synonym:
• LC3B; ATG8F; MAP1LC3B-a; MAP1A/1BLC3; 3B

• Description:
• The antibody against LC3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-107 of human LC3B (Q9GZQ8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 2-107 of human LC3B (Q9GZQ8).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• LC3B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDG

• Gene ID:
• 81631

• Uniprot-ID:
• Q9GZQ8

• Purification Method:
• 293T, C6, NIH/3T3

• Positive Samples:
• Affinity purification