Rabbit anti-Human KDM1 / LSD1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15860P

• Product Name:
• Rabbit anti-Human KDM1 / LSD1 Monoclonal Antibody

• Synonym:
• AOF2; CPRF; KDM1; LSD1; BHC110; KDM1 / LSD1

• Description:
• The antibody against KDM1 / LSD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 700-811 of human KDM1 / LSD1 (NP_055828.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 700-811 of human KDM1 / LSD1 (NP_055828.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• KDM1 / LSD1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• APILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATV

• Gene ID:
• 23028

• Uniprot-ID:
• O60341

• Purification Method:
• HeLa, Jurkat, SH-SY5Y

• Positive Samples:
• Affinity purification