Rabbit anti-Human KCNN3/SK3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15244P

• Product Name:
• Rabbit anti-Human KCNN3/SK3 Monoclonal Antibody

• Synonym:
• SK3; ZLS3; hSK3; SKCA3; KCa2.3; KCNN3/SK3

• Description:
• The antibody against KCNN3/SK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 630-730 of human KCNN3/SK3 (NP_002240.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 630-730 of human KCNN3/SK3 (NP_002240.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• KCNN3/SK3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSSSS

• Gene ID:
• 3782

• Uniprot-ID:
• Q9UGI6

• Positive Samples:
• Affinity purification