Rabbit anti-Human Kaiso/ZBTB33 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14305P

• Product Name:
• Rabbit anti-Human Kaiso/ZBTB33 Monoclonal Antibody

• Synonym:
• ZNF348; ZNF-kaiso; Kaiso/ZBTB33

• Description:
• The antibody against Kaiso/ZBTB33 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 573-672 of human Kaiso/ZBTB33 (Q86T24) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 573-672 of human Kaiso/ZBTB33 (Q86T24).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Kaiso/ZBTB33

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY

• Gene ID:
• 10009

• Uniprot-ID:
• Q86T24

• Purification Method:
• A-549, SH-SY5Y, Rat brain

• Positive Samples:
• Affinity purification