Rabbit anti-Human ITPA Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13211P

• Product Name:
• Rabbit anti-Human ITPA Monoclonal Antibody

• Synonym:
• DEE35; My049; ITPase; NTPase; C20orf37; dJ794I6.3; HLC14-06-P; ITPA

• Description:
• The antibody against ITPA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human ITPA (Q9BY32) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 70-150 of human ITPA (Q9BY32).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ITPA

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFG

• Gene ID:
• 3704

• Uniprot-ID:
• Q9BY32

• Purification Method:
• HT-29, HepG2, Mouse kidney

• Positive Samples:
• Affinity purification