Rabbit anti-Human Integrin β4 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15629P

• Product Name:
• Rabbit anti-Human Integrin β4 Monoclonal Antibody

• Synonym:
• CD104; GP150; JEB5A; JEB5B; Integrin β4

• Description:
• The antibody against Integrin β4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 611-710AA of human Integrin β4 (NP_000204.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 611-710AA of human Integrin β4 (NP_000204.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Integrin β4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGS

• Gene ID:
• 3691

• Uniprot-ID:
• P16144

• Positive Samples:
• Affinity purification