Rabbit anti-Human ILT5/CD85a Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15582P

• Product Name:
• Rabbit anti-Human ILT5/CD85a Monoclonal Antibody

• Synonym:
• LILRB3; CD85A; HL9; ILT-5; ILT5; LILRA6; LIR-3; LIR3; PIR-B; PIRB; leukocyte immunoglobulin like receptor B3; ILT5/CD85a

• Description:
• The antibody against ILT5/CD85a was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-418 of human ILT5/CD85a (NP_006855.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 24-418 of human ILT5/CD85a (NP_006855.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ILT5/CD85a

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVV

• Gene ID:
• 11025

• Uniprot-ID:
• O75022

• Positive Samples:
• Affinity purification