Rabbit anti-Human IL-1RAcP Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14854P

• Product Name:
• Rabbit anti-Human IL-1RAcP Monoclonal Antibody

• Synonym:
• IL1R3; C3orf13; IL-1RAcP

• Description:
• The antibody against IL-1RAcP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 391-470 of human IL-1RAcP (NP_002173.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 391-470 of human IL-1RAcP (NP_002173.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• IL-1RAcP

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AHFGTDETILDGKEYDIYVSYARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSP

• Gene ID:
• 3556

• Uniprot-ID:
• Q9NPH3

• Purification Method:
• KARPAS-299, Mouse lung, Rat brain

• Positive Samples:
• Affinity purification