Rabbit anti-Human IL9 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15454P

• Product Name:
• Rabbit anti-Human IL9 Monoclonal Antibody

• Synonym:
• P40; HP40; IL-9; IL9

• Description:
• The antibody against IL9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-144 of human IL9(NP_000581.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 19-144 of human IL9(NP_000581.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• IL9

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

• Gene ID:
• 3578

• Uniprot-ID:
• P15248

• Purification Method:
• 293T transfected with IL9(Human)

• Positive Samples:
• Affinity purification