Rabbit anti-Human IL1β Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16350P

• Product Name:
• Rabbit anti-Human IL1β Monoclonal Antibody

• Synonym:
• IL-1; IL1F2; IL1beta; IL1-BETA; IL1β

• Description:
• The antibody against IL1β was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 117-269 of human IL1β (NP_000567.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 117-269 of human IL1β (NP_000567.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• IL1β

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

• Gene ID:
• 3553

• Uniprot-ID:
• P01584

• Purification Method:
• Active Recombinant Human IL-1 beta Protein

• Positive Samples:
• Affinity purification