Rabbit anti-Human IL17RA Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13950P

• Product Name:
• Rabbit anti-Human IL17RA Monoclonal Antibody

• Synonym:
• CD217; IL17R; IMD51; CANDF5; CDw217; IL-17RA; hIL-17R; IL17RA

• Description:
• The antibody against IL17RA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 767-866 of human IL17RA (Q96F46) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 767-866 of human IL17RA (Q96F46).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• IL17RA

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GCSRPAMVLTDPHTPYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQRQLLFRQLQKNSGWDTMGSESEGPSA

• Gene ID:
• 23765

• Uniprot-ID:
• Q96F46

• Purification Method:
• Mouse lung, Rat kidney

• Positive Samples:
• Affinity purification