• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti-Human IDO1 Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-13426P
  • Product Name:
  • Rabbit anti-Human IDO1 Monoclonal Antibody
  • Synonym:
  • IDO; INDO; IDO-1; IDO1
  • Description:
  • The antibody against IDO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human IDO1 (P14902) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IDO1 (P14902).
  • Species Reactivity:
  • Human, Mouse
  • Isotype:
  • IgG
  • Application:
  • IHC-P, ELISA
  • Storage Buffer:
  • PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • IDO1
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • IESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDV
  • Gene ID:
  • 3620
  • Purification Method:
  • Mouse ovary
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Human MRRF Monoclonal Antibody-ADA-13425P
  • Online Inquiry

    refresh