Rabbit anti-Human HSPB8/HSP22 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15761P

• Product Name:
• Rabbit anti-Human HSPB8/HSP22 Monoclonal Antibody

• Synonym:
• H11; HMN2; CMT2L; DHMN2; E2IG1; HMN2A; HSP22

• Description:
• The antibody against HSPB8/HSP22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human HSPB8/HSP22 (NP_055180.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human HSPB8/HSP22 (NP_055180.1).

• Species Reactivity:
• Human, Mouse, Rat, Monkey

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• HSPB8/HSP22

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT

• Gene ID:
• 26353

• Uniprot-ID:
• Q9UJY1

• Purification Method:
• COS-7, RD, Mouse skeletal muscle, Mouse heart, Rat skeletal muscle

• Positive Samples:
• Affinity purification