Rabbit anti-Human HSPA4 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16246P

• Product Name:
• Rabbit anti-Human HSPA4 Monoclonal Antibody

• Synonym:
• RY; APG-2; HSPH2; hsp70; hsp70RY; HEL-S-5a; HS24/P52; HSPA4

• Description:
• The antibody against HSPA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human HSPA4 (P34932) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 700-800 of human HSPA4 (P34932).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• HSPA4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNA

• Gene ID:
• 3308

• Uniprot-ID:
• P34932

• Purification Method:
• HeLa, 293T, NIH/3T3, K-562, C6, Mouse testis

• Positive Samples:
• Affinity purification