Rabbit anti-Human HSP47/SERPINH1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16174P

• Product Name:
• Rabbit anti-Human HSP47/SERPINH1 Monoclonal Antibody

• Synonym:
• CBP1; CBP2; OI10; gp46; AsTP3; HSP47; PIG14; PPROM; RA-A47; SERPINH2; HSP47/SERPINH1

• Description:
• The antibody against HSP47/SERPINH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 319-418 of human HSP47/SERPINH1 (P50454) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 319-418 of human HSP47/SERPINH1 (P50454).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• HSP47/SERPINH1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL

• Gene ID:
• 871

• Uniprot-ID:
• P50454

• Purification Method:
• HeLa, NIH/3T3

• Positive Samples:
• Affinity purification