Rabbit anti-Human HSP20/HSPB6 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14202P

• Product Name:
• Rabbit anti-Human HSP20/HSPB6 Monoclonal Antibody

• Synonym:
• HEL55; Hsp20; PPP1R91; HSP20/HSPB6

• Description:
• The antibody against HSP20/HSPB6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human HSP20/HSPB6 (O14558) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 70-150 of human HSP20/HSPB6 (O14558).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• HSP20/HSPB6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS

• Gene ID:
• 126393

• Uniprot-ID:
• O14558

• Purification Method:
• Mouse heart, Rat skeletal muscle

• Positive Samples:
• Affinity purification