Rabbit anti-Human Hsc70/HSPA8 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16456P

• Product Name:
• Rabbit anti-Human Hsc70/HSPA8 Monoclonal Antibody

• Synonym:
• LAP1; HSC54; HSC70; HSC71; HSP71; HSP73; LAP-1; NIP71; HEL-33; HSPA10; HEL-S-72p; Hsc70/HSPA8

• Description:
• The antibody against Hsc70/HSPA8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 547-646 of human Hsc70/HSPA8 (P11142) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 547-646 of human Hsc70/HSPA8 (P11142).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Hsc70/HSPA8

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD

• Gene ID:
• 3312

• Uniprot-ID:
• P11142

• Purification Method:
• HeLa, 293T, NIH/3T3, U-87MG, Mouse brain, Rat brain

• Positive Samples:
• Affinity purification