Rabbit anti-Human Histone H2A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17016P

• Product Name:
• Rabbit anti-Human Histone H2A Monoclonal Antibody

• Synonym:
• H2A.1; H2A.2; H2A/a; H2AC4; H2AFA; HIST1H2AE; Histone H2A

• Description:
• The antibody against Histone H2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2A (P04908) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2A (P04908).

• Species Reactivity:
• Human, Mouse, Rat, Other (Wide Range Predicted)

• Isotype:
• IgG

• Application:
• WB, IHC-P, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Histone H2A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGR

• Gene ID:
• 30128329

• Uniprot-ID:
• P04908

• Purification Method:
• HeLa, HepG2, Jurkat, Mouse spleen, Mouse thymus, Rat liver

• Positive Samples:
• Affinity purification