Rabbit anti-Human Haptoglobin (HP) Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13922P

• Product Name:
• Rabbit anti-Human Haptoglobin (HP) Monoclonal Antibody

• Synonym:
• BP; HPA1S; HP2ALPHA2; Haptoglobin (HP)

• Description:
• The antibody against Haptoglobin (HP) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 307-406 of human Haptoglobin (HP) (P00738) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 307-406 of human Haptoglobin (HP) (P00738).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Haptoglobin (HP)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

• Gene ID:
• 3240

• Uniprot-ID:
• P00738

• Purification Method:
• Human plasma, Mouse liver, Rat liver, Rat plasma

• Positive Samples:
• Affinity purification