Rabbit anti-Human GRM5 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15919P

• Product Name:
• Rabbit anti-Human GRM5 Monoclonal Antibody

• Synonym:
• mGlu5; GPRC1E; MGLUR5; PPP1R86; GRM5

• Description:
• The antibody against GRM5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human GRM5 (P41594) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human GRM5 (P41594).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• GRM5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAARESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL

• Gene ID:
• 2915

• Uniprot-ID:
• P41594

• Purification Method:
• Mouse brain

• Positive Samples:
• Affinity purification