Rabbit anti-Human GRB2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15971P

• Product Name:
• Rabbit anti-Human GRB2 Monoclonal Antibody

• Synonym:
• ASH; Grb3-3; MST084; NCKAP2; MSTP084; EGFRBP-GRB2; GRB2

• Description:
• The antibody against GRB2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 118-217 of human GRB2 (P62993) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 118-217 of human GRB2 (P62993).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• GRB2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• YFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV

• Gene ID:
• 2885

• Uniprot-ID:
• P62993

• Purification Method:
• MCF7, 293T, HL-60, HeLa, NIH/3T3, Mouse brain, Mouse kidney, Rat spleen, Rat brain

• Positive Samples:
• Affinity purification