Rabbit anti-Human Granulin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15185P

• Product Name:
• Rabbit anti-Human Granulin Monoclonal Antibody

• Synonym:
• GEP; GP88; PEPI; PGRN; CLN11; PCDGF; Granulin

• Description:
• The antibody against Granulin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 494-593 of human Granulin (NP_002078.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 494-593 of human Granulin (NP_002078.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Granulin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL

• Gene ID:
• 2896

• Uniprot-ID:
• P28799

• Purification Method:
• HeLa, Mouse liver

• Positive Samples:
• Affinity purification