Rabbit anti-Human GNAI2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13402P

• Product Name:
• Rabbit anti-Human GNAI2 Monoclonal Antibody

• Synonym:
• GIP; HG1C; GNAI2B; H_LUCA15.1; H_LUCA16.1; GNAI2

• Description:
• The antibody against GNAI2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-355 of human GNAI2 (P04899) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 250-355 of human GNAI2 (P04899).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• GNAI2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF

• Gene ID:
• 2771

• Uniprot-ID:
• P04899

• Purification Method:
• U-937, Mouse spleen, Mouse thymus, Rat lung, Rat thymus

• Positive Samples:
• Affinity purification