Rabbit anti-Human GluR1/GRIA1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16011P

• Product Name:
• Rabbit anti-Human GluR1/GRIA1 Monoclonal Antibody

• Synonym:
• GLUH1; GLUR1; GLURA; GluA1; HBGR1; MRD67; MRT76; GluR1/GRIA1

• Description:
• The antibody against GluR1/GRIA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-906 of human GluR1/GRIA1 (P42261) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 800-906 of human GluR1/GRIA1 (P42261).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• GluR1/GRIA1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL

• Gene ID:
• 2890

• Uniprot-ID:
• P42261

• Purification Method:
• Mouse brain, Rat brain

• Positive Samples:
• Affinity purification