Rabbit anti-Human GABA transaminase (ABAT) Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14024P

• Product Name:
• Rabbit anti-Human GABA transaminase (ABAT) Monoclonal Antibody

• Synonym:
• GABAT; NPD009; GABA-AT; GABA transaminase (ABAT)

• Description:
• The antibody against GABA transaminase (ABAT) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABA transaminase (ABAT) (P80404) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABA transaminase (ABAT) (P80404).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• GABA transaminase (ABAT)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQI

• Gene ID:
• 18

• Uniprot-ID:
• P80404

• Purification Method:
• HepG2, BxPC-3, SH-SY5Y, Mouse kidney, Rat kidney

• Positive Samples:
• Affinity purification