Rabbit anti-Human FKBP52/FKBP4 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13850P

• Product Name:
• Rabbit anti-Human FKBP52/FKBP4 Monoclonal Antibody

• Synonym:
• HBI; p52; Hsp56; FKBP51; FKBP52; FKBP59; PPIase; FKBP52/FKBP4

• Description:
• The antibody against FKBP52/FKBP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human FKBP4 (Q02790) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human FKBP4 (Q02790).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• FKBP52/FKBP4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDI

• Gene ID:
• 2288

• Uniprot-ID:
• Q02790

• Purification Method:
• 293T, Jurkat, Mouse testis, Mouse thymus, Rat testis

• Positive Samples:
• Affinity purification