Rabbit anti-Human FKBP51/FKBP5 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14191P

• Product Name:
• Rabbit anti-Human FKBP51/FKBP5 Monoclonal Antibody

• Synonym:
• P54; AIG6; FKBP51; FKBP54; PPIase; Ptg-10; FKBP51/FKBP5

• Description:
• The antibody against FKBP51/FKBP5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-457 of human FKBP51/FKBP5 (Q13451) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 350-457 of human FKBP51/FKBP5 (Q13451).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• FKBP51/FKBP5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV

• Gene ID:
• 2289

• Uniprot-ID:
• Q13451

• Purification Method:
• Mouse testis, Rat testis, HeLa, HT-1080, SH-SY5Y

• Positive Samples:
• Affinity purification