Rabbit anti-Human FAM50A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16313P

• Product Name:
• Rabbit anti-Human FAM50A Monoclonal Antibody

• Synonym:
• XAP5; HXC26; MRXSA; HXC-26; DXS9928E; FAM50A

• Description:
• The antibody against FAM50A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FAM50A (NP_004690.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FAM50A (NP_004690.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• FAM50A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQLAKKEQSKELQMK

• Gene ID:
• 9130

• Uniprot-ID:
• Q14320

• Purification Method:
• U-251MG, PC-12, NIH/3T3, Mouse placenta

• Positive Samples:
• Affinity purification