Rabbit anti-Human FAM20A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15046P

• Product Name:
• Rabbit anti-Human FAM20A Monoclonal Antibody

• Synonym:
• AI1G; AIGFS; FP2747; FAM20A

• Description:
• The antibody against FAM20A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human FAM20A(NP_060035.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 500-600 of human FAM20A(NP_060035.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• FAM20A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AIFDFLIGNMDRHHYEMFTKFGDDGFLIHLDNARGFGRHSHDEISILSPLSQCCMIKKKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVLTEPHLLALDR

• Gene ID:
• 54757

• Uniprot-ID:
• Q96MK3

• Purification Method:
• Hep G2, A-431

• Positive Samples:
• Affinity purification