Rabbit anti-Human ESRα Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15505P

• Product Name:
• Rabbit anti-Human ESRα Monoclonal Antibody

• Synonym:
• ER; ESRα

• Description:
• The antibody against ESRα was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 495-595 of human ESRα (NP_000116.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 495-595 of human ESRα (NP_000116.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IP, ChIP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ESRα

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV

• Gene ID:
• 2099

• Uniprot-ID:
• P03372

• Purification Method:
• MCF7

• Positive Samples:
• Affinity purification