Rabbit anti-Human ERp19 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13446P

• Product Name:
• Rabbit anti-Human ERp19 Monoclonal Antibody

• Synonym:
• AG1; AGR1; ERP16; ERP18; ERP19; TLP19; hAG-1; PDIA16; hTLP19; ERp19

• Description:
• The antibody against ERp19 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ERp19 (NP_056997.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ERp19 (NP_056997.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ERp19

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEP

• Gene ID:
• 51060

• Uniprot-ID:
• O95881

• Purification Method:
• HT-29, 293T, SH-SY5Y, Rat lung, Rat kidney, Rat heart

• Positive Samples:
• Affinity purification