Rabbit anti-Human ERK2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16537P

• Product Name:
• Rabbit anti-Human ERK2 Monoclonal Antibody

• Synonym:
• ERK; p38; p40; p41; ERK2; ERT1; NS13; ERK-2; MAPK2; PRKM1; PRKM2; P42MAPK; p41mapk; p42-MAPK

• Description:
• The antibody against ERK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human ERK2ERK1/2 (P27361/P28482) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ERK2ERK1/2 (P27361/P28482).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ERK2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD/LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK

• Gene ID:
• 5594

• Uniprot-ID:
• P28482

• Purification Method:
• K-562, Mouse brain, Mouse liver, Mouse spleen, Rat brain, Rat spleen

• Positive Samples:
• Affinity purification