Rabbit anti-Human ERK1/2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17150P

• Product Name:
• Rabbit anti-Human ERK1/2 Monoclonal Antibody

• Synonym:
• ERK; ERK-2; ERK2; ERT1; MAPK2; P42MAPK; PRKM1; PRKM2; p38; p40; p41; p41mapk; p42-MAPK; 5594/5595; ERK1/2

• Description:
• The antibody against ERK1/2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-360 of human ERK2 (P28482) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 180-360 of human ERK2 (P28482).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ERK1/2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

• Gene ID:
• 55945595

• Uniprot-ID:
• P28482

• Purification Method:
• HeLa, 293T, A-431, NIH/3T3, PC-12, C6, Mouse brain, Rat brain

• Positive Samples:
• Affinity purification