Rabbit anti-Human EpCAM Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16990P

• Product Name:
• Rabbit anti-Human EpCAM Monoclonal Antibody

• Synonym:
• ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1; EpCAM

• Description:
• The antibody against EpCAM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 215-314 of human EpCAM (P16422) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 215-314 of human EpCAM (P16422).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• EpCAM

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• YFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA

• Gene ID:
• 4072

• Uniprot-ID:
• P16422

• Positive Samples:
• Affinity purification