Rabbit anti-Human eIF4EBP1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15270P

• Product Name:
• Rabbit anti-Human eIF4EBP1 Monoclonal Antibody

• Synonym:
• BP-1; 4EBP1; 4E-BP1; PHAS-I; [KD Validated] eIF4EBP1

• Description:
• The antibody against eIF4EBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4EBP1 (NP_004086.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4EBP1 (NP_004086.1).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• eIF4EBP1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRN

• Gene ID:
• 1978

• Uniprot-ID:
• Q13541

• Purification Method:
• HeLa

• Positive Samples:
• Affinity purification