Rabbit anti-Human eEF1A1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13773P

• Product Name:
• Rabbit anti-Human eEF1A1 Monoclonal Antibody

• Synonym:
• CCS3; EF1A; PTI1; CCS-3; EE1A1; EEF-1; EEF1A; EF-Tu; EF1A1; LENG7; eEF1A-1; GRAF-1EF; EF1alpha1; eEF1A1

• Description:
• The antibody against eEF1A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human eEF1A1 (NP_001393.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 250-350 of human eEF1A1 (NP_001393.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• eEF1A1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP

• Gene ID:
• 1915

• Uniprot-ID:
• P68104

• Purification Method:
• HeLa, 293T, MCF7, Mouse lung, Mouse liver, Mouse kidney, Rat kidney

• Positive Samples:
• Affinity purification