Rabbit anti-Human EDG1/HEXIM1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16042P

• Product Name:
• Rabbit anti-Human EDG1/HEXIM1 Monoclonal Antibody

• Synonym:
• EDG1; S1P1; CD363; ECGF1; EDG-1; CHEDG1; D1S3362; EDG1/HEXIM1

• Description:
• The antibody against EDG1/HEXIM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human EDG1/HEXIM1 (P21453) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EDG1/HEXIM1 (P21453).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• EDG1/HEXIM1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTA

• Gene ID:
• 1901

• Uniprot-ID:
• P21453

• Purification Method:
• BxPC-3, A-375, HUVEC, Mouse lung, Mouse brain, Mouse spleen, Rat lung, Rat heart

• Positive Samples:
• Affinity purification