Rabbit anti-Human E2F1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16999P

• Product Name:
• Rabbit anti-Human E2F1 Monoclonal Antibody

• Synonym:
• RBP3; E2F-1; RBAP1; RBBP3; E2F1

• Description:
• The antibody against E2F1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 338-437 of human E2F1 (Q01094) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 338-437 of human E2F1 (Q01094).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• E2F1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF

• Gene ID:
• 1869

• Uniprot-ID:
• Q01094

• Purification Method:
• U-87MG, HT-29, HeLa, A-431, Mouse testis, Mouse brain, Rat thymus, Rat spleen

• Positive Samples:
• Affinity purification