Rabbit anti-Human Dot1L/KMT4 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16779P

• Product Name:
• Rabbit anti-Human Dot1L/KMT4 Monoclonal Antibody

• Synonym:
• DOT1; KMT4; Dot1L/KMT4

• Description:
• The antibody against Dot1L/KMT4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dot1L/KMT4 (NP_115871.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dot1L/KMT4 (NP_115871.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Dot1L/KMT4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNT

• Gene ID:
• 84444

• Uniprot-ID:
• Q8TEK3

• Purification Method:
• HeLa, U-87MG, Mouse brain

• Positive Samples:
• Affinity purification