Rabbit anti-Human DiMethyl-Histone H3-K36 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14818P

• Product Name:
• Rabbit anti-Human DiMethyl-Histone H3-K36 Monoclonal Antibody

• Synonym:
• H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36

• Description:
• The antibody against DiMethyl-Histone H3-K36 was raised in Rabbit using a synthetic dimethylated peptide around K36 of human Histone H3 (NP_003520.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA, DB.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic dimethylated peptide around K36 of human Histone H3 (NP_003520.1).

• Species Reactivity:
• Human, Mouse, Rat, Other (Wide Range Predicted)

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA, DB

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• DiMethyl-Histone H3-K36

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY

• Gene ID:
• 82908350

• Uniprot-ID:
• Q16695

• Purification Method:
• MCF7, NIH/3T3, C6

• Positive Samples:
• Affinity purification