Rabbit anti-Human DDX6 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16154P

• Product Name:
• Rabbit anti-Human DDX6 Monoclonal Antibody

• Synonym:
• P54; RCK; HLR2; IDDILF; Rck/p54; DDX6

• Description:
• The antibody against DDX6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human DDX6 (P26196) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human DDX6 (P26196).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• DDX6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• YCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATT

• Gene ID:
• 1656

• Uniprot-ID:
• P26196

• Purification Method:
• Hep G2, C2C12

• Positive Samples:
• Affinity purification