• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti-Human DcR1/CD263 Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-15605P
  • Product Name:
  • Rabbit anti-Human DcR1/CD263 Monoclonal Antibody
  • Synonym:
  • TNFRSF10C; CD263; DCR1; DCR1-TNFR; LIT; TRAIL-R3; TRAILR3; TRID; TNF receptor superfamily member 10c; DcR1/CD263
  • Description:
  • The antibody against DcR1/CD263 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-235 of human DcR1/CD263 (NP_003832.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, FC, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 26-235 of human DcR1/CD263 (NP_003832.3).
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB, IHC-P, FC, ELISA
  • Storage Buffer:
  • PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • DcR1/CD263
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTP
  • Gene ID:
  • 8794
  • Purification Method:
  • BeWo
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Human SSCA1/SerpinB3 Monoclonal Antibody-ADA-15604P
  • Online Inquiry

    refresh