Rabbit anti-Human DcR1/CD263 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14195P

• Product Name:
• Rabbit anti-Human DcR1/CD263 Monoclonal Antibody

• Synonym:
• TNFRSF10C; CD263; DCR1; DCR1-TNFR; LIT; TRAIL-R3; TRAILR3; TRID; TNF receptor superfamily member 10c; DcR1/CD263

• Description:
• The antibody against DcR1/CD263 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-235 of human DcR1/CD263 (NP_003832.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 26-235 of human DcR1/CD263 (NP_003832.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• DcR1/CD263

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTP

• Gene ID:
• 8794

• Uniprot-ID:
• O14798

• Purification Method:
• T-47D

• Positive Samples:
• Affinity purification