Rabbit anti-Human DCP1A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16112P

• Product Name:
• Rabbit anti-Human DCP1A Monoclonal Antibody

• Synonym:
• SMIF; SMAD4IP1; HSA275986; Nbla00360; DCP1A

• Description:
• The antibody against DCP1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 483-582 of human DCP1A (Q9NPI6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 483-582 of human DCP1A (Q9NPI6).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• DCP1A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL

• Gene ID:
• 55802

• Uniprot-ID:
• Q9NPI6

• Purification Method:
• HeLa, 293T, HepG2, SH-SY5Y

• Positive Samples:
• Affinity purification