Rabbit anti-Human Cystatin C Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16126P

• Product Name:
• Rabbit anti-Human Cystatin C Monoclonal Antibody

• Synonym:
• ARMD11; HEL-S-2; Cystatin C

• Description:
• The antibody against Cystatin C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-146 of human Cystatin C (P01034) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-146 of human Cystatin C (P01034).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Cystatin C

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

• Gene ID:
• 1471

• Uniprot-ID:
• P01034

• Purification Method:
• Human plasma, HeLa, SH-SY5Y, Mouse lung,

• Positive Samples:
• Affinity purification