Rabbit anti-Human CYP3A4 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14827P

• Product Name:
• Rabbit anti-Human CYP3A4 Monoclonal Antibody

• Synonym:
• HLP; CP33; CP34; CYP3A; NF-25; VDDR3; CYP3A3; P450C3; CYPIIIA3; CYPIIIA4; P450PCN1; CYP3A4

• Description:
• The antibody against CYP3A4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-503 of human CYP3A4 (NP_059488.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 400-503 of human CYP3A4 (NP_059488.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CYP3A4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA

• Gene ID:
• 1576

• Uniprot-ID:
• P08684

• Purification Method:
• 293F transfected with CYP3A4

• Positive Samples:
• Affinity purification