Rabbit anti-Human CYP2D6 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16144P

• Product Name:
• Rabbit anti-Human CYP2D6 Monoclonal Antibody

• Synonym:
• CPD6; CYP2D; CYP2DL1; CYPIID6; P450C2D; P450DB1; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; P450-DB1; CYP2D6

• Description:
• The antibody against CYP2D6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 341-497 of human CYP2D6 (P10635) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 341-497 of human CYP2D6 (P10635).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CYP2D6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR

• Gene ID:
• 1565

• Uniprot-ID:
• P10635

• Purification Method:
• HT-29, 293T, Hep G2, Mouse liver, Rat liver

• Positive Samples:
• Affinity purification