Rabbit anti-Human CYP27A1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16400P

• Product Name:
• Rabbit anti-Human CYP27A1 Monoclonal Antibody

• Synonym:
• CTX; CP27; CYP27; CYP27A1

• Description:
• The antibody against CYP27A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 431-530 of human CYP27A1 (NP_000775.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 431-530 of human CYP27A1 (NP_000775.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CYP27A1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQ

• Gene ID:
• 1593

• Uniprot-ID:
• Q02318

• Purification Method:
• Mouse liver, Rat liver

• Positive Samples:
• Affinity purification